Filing Flows

Filing Flows › Technology › Wolfspeed (WOLF)

Wolfspeed (WOLF) earnings and revenue breakdown

Latest: Q1 FY27 · 10-Q filed Nov 5, 2026 · Wolfspeed (WOLF) Q1 FY27 earnings results →

Q1 FY27 Revenue down 21% year over year to $155M · 93¢ of every $1 of revenue lost · operating margin -72.8%

Wolfspeed made $155M in Q1 FY27 (-21% Y/Y): Power Products $117M, Materials Products $38.2M. Operating margin -72.8%, net loss $144M. See where every dollar goes — costs, profit and cash — as a Sankey from the 10-Q filed Nov 5, 2026.

Revenue$155M
Year over year-21%
Operating margin-72.8%
Net earnings−$144M
Operating cash flow−$84.2M

Drawing the Sankey…

Open the interactive Sankey → click any line for what the company wrote about it, compare Y/Y and Q/Q, export as PNG or PDF

What changed this quarter

Revenue was $155.0M in Q1 FY27, down 21% year over year and up 4% from the previous quarter. Power Products was the largest line at 75% of revenue. Materials Products lost $26.8M year over year (down 41%), 64% of the total change.

Operating costs exceeded revenue by $112.8M, an operating margin of -72.8%. Total costs fell 25% while revenue fell 21%. The quarter ended with a net loss of $143.8M, narrower than the previous quarter's $145.3M loss.

Operating cash flow was −$84.2M. Non-cash charges added back $29.2M of depreciation and amortization and $10.3M of share-based compensation. Working capital and other items added $20.1M. Capital expenditures of $10.6M exceeded it, leaving free cash flow of −$94.8M.

Quarterly history

Wolfspeed revenue by quarterWolfspeed revenue by quarter$180MQ2 FY25$185MQ3 FY25$197MQ4 FY25$197MQ1 FY26$168MQ2 FY26$150MQ3 FY26$155MQ1 FY27
Wolfspeed net earnings by quarterWolfspeed net earnings by quarter−$372MQ2 FY25−$286MQ3 FY25−$669MQ4 FY25−$644MQ1 FY26−$151MQ2 FY26−$120MQ3 FY26−$144MQ1 FY27
QuarterFormFiledRevenueY/YOp. marginNet earningsOp. cash flow
Q1 FY2710-QNov 5, 2026$155M-21%-72.8%−$144M−$84.2M
Q3 FY2610-QMay 7, 2026$150M-19%-76.1%−$120M−$83.8M
Q2 FY2610-QFeb 6, 2026$168M-7%-94.0%−$151M−$42.6M
Q1 FY2610-QNov 7, 2025$197M+1%-82.0%−$644M$5.7M
Q4 FY2510-KAug 26, 2025$197M-2%-295.2%−$669M−$242M
Q3 FY2510-QMay 9, 2025$185M-8%-104.9%−$286M−$142M
Q2 FY2510-QJan 30, 2025$180M-13%-178.9%−$372M−$195M

Charts

Wolfspeed: revenue growth, year over year and quarter over quarterWolfspeed: revenue growth, year over year and quarter over quarterY/YQ/Q-13%Q2 FY25-8%+3%Q3 FY25-2%+6%Q4 FY25+1%0%Q1 FY26-7%-14%Q2 FY26-19%-11%Q3 FY26-21%+3%Q1 FY27
Latest (Q1 FY27): Y/Y -21%, Q/Q +3%.
Wolfspeed: where the cash came from (+) and went (−), FY25Wolfspeed: where the cash came from (+) and went (−), FY25Capital spending−$1.3BOther investing$917MOperating cash flow−$712MCash drawn (+) / kept (−)$579MShares issued$204MOther financing$201MAsset & business sales$85.9MTaxes on employees’ shares−$3.9MExchange rates$1.0MNet borrowing (+) / repaid (−)−$500K
From the cash-flow statement as filed (SEC XBRL). Cash is fungible: the bars do not say which dollar paid for what.
Wolfspeed: profit against cash, quarter by quarterWolfspeed: profit against cash, quarter by quarterNet incomeOperating cash flow−$286M−$142MQ3 FY25−$669M−$242MQ4 FY25−$644M$5.7MQ1 FY26$420M−$22.4MQ1 FY26−$151M−$42.6MQ2 FY26−$120M−$83.8MQ3 FY26−$145M−$54.4MQ4 FY26−$144M−$84.2MQ1 FY27
Latest (Q1 FY27): Net income −$144M, Operating cash flow −$84.2M.
Wolfspeed: diluted shares by fiscal yearWolfspeed: diluted shares by fiscal year108MFY20112MFY21120MFY22124MFY23126MFY24141MFY25
+30.9% since FY20: more shares outstanding (issuance, stock pay).
Wolfspeed in its industry: growth against margin (80 companies, SIC 3674)Wolfspeed in its industry: growth against margin (80 companies, SIC 3674)revenue growth, year over year →↑ operating marginmedian +36%median 11%NVDAMUAVGOINTCAMDAMATTXNADINXPIMRVLAMKRONMCHPQARMFSLRMPWRNXTSWKSQorvo, Inc.UCTTALABPENGCRUSDIODCRDOVIAVMTSIOSISSMTCKLICARRYICHRSEDGSITMSYNAENPHLSCCIPGPFORMALGMAAOITESLABRMBSMXLPLABSHLSCBRSAOSLSkyWater Technology, LLCPOWINLSTAMBALASRAXTIINDIMXAMBQFTCIAIPTYGOLPTHMRAMNVTSKOPNBZAIGUERLEDSGSITNVECSODIQUIKPRSOGCTSMOBXALMUASTIIPWRWOLF (-21%, -73%)
Semiconductors & Related Devices; dot size is quarterly revenue; dashed lines are the industry's medians.

Interactive views

The same charts as the app — open one to draw it.

💵Where each $1 goesinteractive

Loading the interactive chart…

🌏Named in Asian annual reportsinteractive

Loading the interactive chart…

🔄Rotation against the market and its industry (RRG)interactive

Loading the interactive chart…

🔍Earnings qualityinteractive

Loading the interactive chart…

⚖️Fair value by methodinteractive

Loading the interactive chart…

🔭Outlook & guidanceinteractive

Loading the interactive chart…

📈Investments: gains and what it boughtinteractive

Loading the interactive chart…

🏭Its industry’s money flow (input-output)interactive

Loading the interactive chart…

About Wolfspeed

Wolfspeed, Inc. ("Wolfspeed", the "Company", "we", "our", or "us") is an innovator of wide bandgap semiconductors, focused on silicon carbide materials and devices for power applications. Our product families include silicon carbide materials and power devices. Our products are targeted for various applications in the Automotive domain, including electric vehicles and fast charging, as well as existing and emerging applications in the Industrial & Energy domain such as AI data centers, grid modernization and renewable energy and storage as well as aerospace and defense.

In its own words, from its 10-K, filed Aug 20, 2026.

Wolfspeed against its Semiconductors & Related Devices peers

The largest companies of the same SEC industry, each at its latest quarter. Revenue growth: -21% against the peers' median +40%. Operating margin: -72.8% against the peers' median 40.1%.

CompanyQuarterRevenueY/YOp. margin
WOLF WolfspeedQ1 FY27$155M-21%-72.8%
NVDA NVIDIAQ2 FY27$96.2B+106%66.2%
MU Micron TechnologyQ4 FY26$54.2B+379%80.7%
AVGO BroadcomQ3 FY26$29.6B+86%53.9%
INTC IntelQ3 2026$16.5B+21%15.3%
AMD Advanced Micro DevicesQ3 2026$13.4B+45%21.2%
AMAT Applied MaterialsQ3 FY26$9.1B+25%33.7%
TXN Texas InstrumentsQ3 2026$6.1B+28%47.5%
ADI Analog DevicesQ3 FY26$4.0B+40%40.1%

Source: Wolfspeed 10-Q on SEC EDGAR · CIK 895419 · Semiconductors & Related Devices

Guidance and outlook

Wolfspeed Revenue: guidance against what was reportedWolfspeed Revenue: guidance against what was reportedguided rangereported (above / within / below)Q4 FY26Q1 FY27$155MQ2 FY27
Met or beat 1 of 1 guided periods. Grey: the last range guided before the figures came out; dot: the reported figure.
Wolfspeed: what its forward-looking statements are about (10-Q filed 2026-11-05)Wolfspeed: what its forward-looking statements are about (10-Q filed 2026-11-05)Other8Demand5Costs3Supply chain2Financing1Margins1
20 statements; tone +0.15 (−1 all cautious, +1 all confident); 6 hedged.
Wolfspeed: outlook statements against the filing beforeWolfspeed: outlook statements against the filing beforeConfident4Cautious1

13F: who owns WOLF and who is buying

Largest holders of WOLF (13F)Largest holders of WOLF (13F)Renesas Electronics America$813MSlate Path Capital LP$214MPrice T Rowe Associates$147MState Street$126MBlackRock$114MGoldman Sachs Group$112MTwo Sigma Investments, LP$110MMorgan Stanley$97.2MFirst Manhattan Co. LLC.$79.4MVanguard Capital Management LLC$66.6M
Funds' net buying of WOLF by quarter (13F)Funds' net buying of WOLF by quarter (13F)$02024-09$02024-12−$1K2025-03$02025-06$487M2025-09$181M2025-12−$91.7M2026-03$451M2026-06
Value of shares 13F filers added minus the value they sold, each quarter (quarters with most filings in).

More on WOLF

History

Every quarter: Q1 FY27 results · Q3 FY26 results · Q2 FY26 results · Q1 FY26 results · Q4 FY25 results · Q3 FY25 results · Q2 FY25 results

Compare WOLF with

中文版：Wolfspeed（WOLF）财报

Español · Français